Εναλλακτικές αναζητήσεις:
evolves. » evolved. (Επέκταση αναζήτησης), evolve. (Επέκταση αναζήτησης)
revolves. » revolved. (Επέκταση αναζήτησης), revolve. (Επέκταση αναζήτησης), resolves. (Επέκταση αναζήτησης), evolved. (Επέκταση αναζήτησης), evolve. (Επέκταση αναζήτησης)
evolves. » evolved. (Επέκταση αναζήτησης), evolve. (Επέκταση αναζήτησης)
revolves. » revolved. (Επέκταση αναζήτησης), revolve. (Επέκταση αναζήτησης), resolves. (Επέκταση αναζήτησης), evolved. (Επέκταση αναζήτησης), evolve. (Επέκταση αναζήτησης)
-
461
-
462
-
463
Cascade Reactions of Dialkynyl Fischer Carbene Complexes Involving Intramolecular Alkyne Insertions Oriented to the Synthesis of Functionalized Polycycles
Έκδοση 2008“…In these cases, naphtalene derivatives substituted with a TMS-ketene are obtained in sequences that involve alkyne exo insertion followed by CO migration. …”
-
464
-
465
-
466
Mechanism of Vanadium-Catalyzed Deoxydehydration of Vicinal Diols: Spin-Crossover-Involved Processes
Έκδοση 2016“…We found that the favorable mechanism involves the condensation of diols to form vanadium(V) diolate, reduction of the vanadium(V) diolate by PPh<sub>3</sub>, and spin-crossover steps to form a triplet vanadium(III) diolate. …”
-
467
-
468
The basic stages involved in serial analysis of gene expression (SAGE) and microarray technology
Έκδοση 2011“…</p><p>Copyright © 2000 GenomeBiology.com</p> (a) SAGE is a sequence-based method of identifying differentially expressed cDNAs between two experimental samples. The technique involves the generation of gene-specific tags typically 10-14 basepairs in length []. …”
-
469
-
470
Supplementary Material for: Carcinoid Heart Disease without Severe Tricuspid Valve Involvement
Έκδοση 2016“…Herein, we report 2 cases of carcinoid-induced valvular heart disease; one case had no evidence of tricuspid valve involvement despite severe involvement of all other valves, while the other case was without severe tricuspid valve involvement.…”
-
471
-
472
-
473
-
474
Model of the apoA-I peptide probably involved in the heparin binding site.
Έκδοση 2015“…The sequence loaded involves residues 143–186 in the wt form (PLGEEMRDRARAHVDALRTHLAPYSDELRQ<b>R</b>LAARLEALKENGG). …”
-
475
WNK Signaling Is Involved in Neural Development via Lhx8/Awh Expression
Έκδοση 2013“…Some mutations in human WNK1 or WNK4 are associated with Pseudohypoaldosteronism type II, a form of hypertension. WNK is also involved in developmental and cellular processes, but the molecular mechanisms underlying its regulation in these processes remain unknown. …”
-
476
Proteomic analysis of reproduction proteins involved in litter size from porcine placenta
Έκδοση 2015“…These results indicate that PSA and RBP4 are representative proteins involved in porcine fertility traits, and this finding may help to increase litter size of pigs.…”
-
477
-
478
The equivalence principle involving electric charges: Rohrlich’s contribution for the discussion on that classical problem
Έκδοση 2021“…The idealizations concerning the so-called “Einstein elevator” containing observers and test masses enable us to readily understand such a concept, however the scenario becomes more complex when there are electric charges involved because they emit radiation when accelerated. …”
-
479
Supplementary Material for: AMH and AMHR2 Involvement in Congenital Disorders of Sex Development
Έκδοση 2021“…Anti-müllerian hormone (AMH) is 1 of the 2 testicular hormones involved in male development of the genitalia during fetal life. …”
-
480
Image_5_Identification of Domains and Factors Involved in MINIYO Nuclear Import.jpeg
Έκδοση 2019“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”