Εμφανίζονται 461 - 480 Αποτελέσματα από 28.566 για την αναζήτηση 'form is (((((evolves. OR involves.) OR involves.) OR evolveddsds.) OR involved.) OR revolves.)', χρόνος αναζήτησης: 2,89δλ Περιορισμός αποτελεσμάτων
  1. 461
  2. 462
  3. 463

    Cascade Reactions of Dialkynyl Fischer Carbene Complexes Involving Intramolecular Alkyne Insertions Oriented to the Synthesis of Functionalized Polycycles ανά José Barluenga (1997692)

    Έκδοση 2008
    “…In these cases, naphtalene derivatives substituted with a TMS-ketene are obtained in sequences that involve alkyne exo insertion followed by CO migration. …”
  4. 464
  5. 465
  6. 466

    Mechanism of Vanadium-Catalyzed Deoxydehydration of Vicinal Diols: Spin-Crossover-Involved Processes ανά Yuan-Ye Jiang (1642738)

    Έκδοση 2016
    “…We found that the favorable mechanism involves the condensation of diols to form vanadium­(V) diolate, reduction of the vanadium­(V) diolate by PPh<sub>3</sub>, and spin-crossover steps to form a triplet vanadium­(III) diolate. …”
  7. 467
  8. 468

    The basic stages involved in serial analysis of gene expression (SAGE) and microarray technology ανά D Paul Harkin (55001)

    Έκδοση 2011
    “…</p><p>Copyright © 2000 GenomeBiology.com</p> (a) SAGE is a sequence-based method of identifying differentially expressed cDNAs between two experimental samples. The technique involves the generation of gene-specific tags typically 10-14 basepairs in length []. …”
  9. 469
  10. 470

    Supplementary Material for: Carcinoid Heart Disease without Severe Tricuspid Valve Involvement ανά Killu A.M. (3230166)

    Έκδοση 2016
    “…Herein, we report 2 cases of carcinoid-induced valvular heart disease; one case had no evidence of tricuspid valve involvement despite severe involvement of all other valves, while the other case was without severe tricuspid valve involvement.…”
  11. 471
  12. 472
  13. 473
  14. 474

    Model of the apoA-I peptide probably involved in the heparin binding site. ανά Silvana A. Rosú (736124)

    Έκδοση 2015
    “…The sequence loaded involves residues 143–186 in the wt form (PLGEEMRDRARAHVDALRTHLAPYSDELRQ<b>R</b>LAARLEALKENGG). …”
  15. 475

    WNK Signaling Is Involved in Neural Development via Lhx8/Awh Expression ανά Atsushi Sato (275996)

    Έκδοση 2013
    “…Some mutations in human WNK1 or WNK4 are associated with Pseudohypoaldosteronism type II, a form of hypertension. WNK is also involved in developmental and cellular processes, but the molecular mechanisms underlying its regulation in these processes remain unknown. …”
  16. 476

    Proteomic analysis of reproduction proteins involved in litter size from porcine placenta ανά Dong-Gi Lee (731388)

    Έκδοση 2015
    “…These results indicate that PSA and RBP4 are representative proteins involved in porcine fertility traits, and this finding may help to increase litter size of pigs.…”
  17. 477
  18. 478

    The equivalence principle involving electric charges: Rohrlich’s contribution for the discussion on that classical problem ανά Edgard de Freitas Diniz Evangelista (10478480)

    Έκδοση 2021
    “…The idealizations concerning the so-called “Einstein elevator” containing observers and test masses enable us to readily understand such a concept, however the scenario becomes more complex when there are electric charges involved because they emit radiation when accelerated. …”
  19. 479

    Supplementary Material for: AMH and AMHR2 Involvement in Congenital Disorders of Sex Development ανά Brunello F.G. (11360232)

    Έκδοση 2021
    “…Anti-müllerian hormone (AMH) is 1 of the 2 testicular hormones involved in male development of the genitalia during fetal life. …”
  20. 480

    Image_5_Identification of Domains and Factors Involved in MINIYO Nuclear Import.jpeg ανά Ramon Contreras (7364087)

    Έκδοση 2019
    “…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”