Flow diagram applied to select studies that involve the function of miRNAs with the development, monitoring, or prognosis of Chagas cardiomyopathy. Autor Heriks Gomes Ribeiro (17889106)

Bifurcated Polymorphic Transition and Thermochromic Fluorescence of a Molecular Crystal Involving Three-Dimensional Supramolecular Gear Rotation Autor Yun-Hsuan Yang (18088273)

Cascade Reactions of Dialkynyl Fischer Carbene Complexes Involving Intramolecular Alkyne Insertions Oriented to the Synthesis of Functionalized Polycycles Autor José Barluenga (1997692)

“…In these cases, naphtalene derivatives substituted with a TMS-ketene are obtained in sequences that involve alkyne exo insertion followed by CO migration. …”

Normalised histograms of distances between atoms involved in backbone-backbone hydrogen bonds. Autor Stefan Auer (260906)

Schematic illustration of the molecular processes involving MinD, MinE, and the membrane. Autor Mike Bonny (493197)

Mechanism of Vanadium-Catalyzed Deoxydehydration of Vicinal Diols: Spin-Crossover-Involved Processes Autor Yuan-Ye Jiang (1642738)

“…We found that the favorable mechanism involves the condensation of diols to form vanadium­(V) diolate, reduction of the vanadium­(V) diolate by PPh₃, and spin-crossover steps to form a triplet vanadium­(III) diolate. …”

Schematic representation of the domains of CHPV N involved in interaction with P and their functional importance. Autor Arindam Mondal (173896)

The basic stages involved in serial analysis of gene expression (SAGE) and microarray technology Autor D Paul Harkin (55001)

“…</p><p>Copyright © 2000 GenomeBiology.com</p> (a) SAGE is a sequence-based method of identifying differentially expressed cDNAs between two experimental samples. The technique involves the generation of gene-specific tags typically 10-14 basepairs in length []. …”

Alternations involving BioIE top-10 verbs in the CYP450 section. Autor K. Bretonnel Cohen (275264)

Supplementary Material for: Carcinoid Heart Disease without Severe Tricuspid Valve Involvement Autor Killu A.M. (3230166)

“…Herein, we report 2 cases of carcinoid-induced valvular heart disease; one case had no evidence of tricuspid valve involvement despite severe involvement of all other valves, while the other case was without severe tricuspid valve involvement.…”

A schematic of the scales involved in the model and the important events considered in each scale. Autor Hossein Bazmara (749931)

Involvement of PI3K in galectin-3 induced Rac1 activation. Autor Violet R. Mukaro (282939)

Expression of proteins involved in axonal survival and death pathways in the superior mesenteric ganglion. Autor Nahia Ezkurdia (506041)

Model of the apoA-I peptide probably involved in the heparin binding site. Autor Silvana A. Rosú (736124)

“…The sequence loaded involves residues 143–186 in the wt form (PLGEEMRDRARAHVDALRTHLAPYSDELRQ<b>R</b>LAARLEALKENGG). …”

WNK Signaling Is Involved in Neural Development via Lhx8/Awh Expression Autor Atsushi Sato (275996)

“…Some mutations in human WNK1 or WNK4 are associated with Pseudohypoaldosteronism type II, a form of hypertension. WNK is also involved in developmental and cellular processes, but the molecular mechanisms underlying its regulation in these processes remain unknown. …”

Proteomic analysis of reproduction proteins involved in litter size from porcine placenta Autor Dong-Gi Lee (731388)

“…These results indicate that PSA and RBP4 are representative proteins involved in porcine fertility traits, and this finding may help to increase litter size of pigs.…”

Conserved elements in steroidogenesis machinery involved in cholesterol transport from humans to worms. Autor Jinjiang Fan (211493)

The equivalence principle involving electric charges: Rohrlich’s contribution for the discussion on that classical problem Autor Edgard de Freitas Diniz Evangelista (10478480)

“…The idealizations concerning the so-called “Einstein elevator” containing observers and test masses enable us to readily understand such a concept, however the scenario becomes more complex when there are electric charges involved because they emit radiation when accelerated. …”

Supplementary Material for: AMH and AMHR2 Involvement in Congenital Disorders of Sex Development Autor Brunello F.G. (11360232)

“…Anti-müllerian hormone (AMH) is 1 of the 2 testicular hormones involved in male development of the genitalia during fetal life. …”

Image_5_Identification of Domains and Factors Involved in MINIYO Nuclear Import.jpeg Autor Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”