Alternativní vyhledávání:
evolves. » evolved. (Rozšířit vyhledávání), evolve. (Rozšířit vyhledávání)
resolvesdsssds. » resolvedsdsssds. (Rozšířit vyhledávání)
resolve. » resolved. (Rozšířit vyhledávání)
evolves. » evolved. (Rozšířit vyhledávání), evolve. (Rozšířit vyhledávání)
resolvesdsssds. » resolvedsdsssds. (Rozšířit vyhledávání)
resolve. » resolved. (Rozšířit vyhledávání)
-
481
-
482
-
483
-
484
Model of the apoA-I peptide probably involved in the heparin binding site.
Vydáno 2015“…The sequence loaded involves residues 143–186 in the wt form (PLGEEMRDRARAHVDALRTHLAPYSDELRQ<b>R</b>LAARLEALKENGG). …”
-
485
WNK Signaling Is Involved in Neural Development via Lhx8/Awh Expression
Vydáno 2013“…Some mutations in human WNK1 or WNK4 are associated with Pseudohypoaldosteronism type II, a form of hypertension. WNK is also involved in developmental and cellular processes, but the molecular mechanisms underlying its regulation in these processes remain unknown. …”
-
486
Proteomic analysis of reproduction proteins involved in litter size from porcine placenta
Vydáno 2015“…These results indicate that PSA and RBP4 are representative proteins involved in porcine fertility traits, and this finding may help to increase litter size of pigs.…”
-
487
-
488
The equivalence principle involving electric charges: Rohrlich’s contribution for the discussion on that classical problem
Vydáno 2021“…The idealizations concerning the so-called “Einstein elevator” containing observers and test masses enable us to readily understand such a concept, however the scenario becomes more complex when there are electric charges involved because they emit radiation when accelerated. …”
-
489
Supplementary Material for: AMH and AMHR2 Involvement in Congenital Disorders of Sex Development
Vydáno 2021“…Anti-müllerian hormone (AMH) is 1 of the 2 testicular hormones involved in male development of the genitalia during fetal life. …”
-
490
Image_5_Identification of Domains and Factors Involved in MINIYO Nuclear Import.jpeg
Vydáno 2019“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”
-
491
Table_1_Identification of Domains and Factors Involved in MINIYO Nuclear Import.docx
Vydáno 2019“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”
-
492
Image_1_Identification of Domains and Factors Involved in MINIYO Nuclear Import.pdf
Vydáno 2019“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”
-
493
Image_2_Identification of Domains and Factors Involved in MINIYO Nuclear Import.tif
Vydáno 2019“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”
-
494
Image_4_Identification of Domains and Factors Involved in MINIYO Nuclear Import.tif
Vydáno 2019“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”
-
495
N- and C-Terminal Hydrophobic Patches Are Involved in Fibrillation of Glucagon<sup>†</sup>
Vydáno 2006“…In contrast, under alkaline conditions, only a handful of the alanine mutants are capable of forming fibrils, suggesting that more side chains are involved in stabilizing interactions here. …”
-
496
-
497
Image_3_Identification of Domains and Factors Involved in MINIYO Nuclear Import.jpeg
Vydáno 2019“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”
-
498
-
499
-
500