A schematic of the scales involved in the model and the important events considered in each scale. Autor Hossein Bazmara (749931)

Involvement of PI3K in galectin-3 induced Rac1 activation. Autor Violet R. Mukaro (282939)

Expression of proteins involved in axonal survival and death pathways in the superior mesenteric ganglion. Autor Nahia Ezkurdia (506041)

Model of the apoA-I peptide probably involved in the heparin binding site. Autor Silvana A. Rosú (736124)

“…The sequence loaded involves residues 143–186 in the wt form (PLGEEMRDRARAHVDALRTHLAPYSDELRQ<b>R</b>LAARLEALKENGG). …”

WNK Signaling Is Involved in Neural Development via Lhx8/Awh Expression Autor Atsushi Sato (275996)

“…Some mutations in human WNK1 or WNK4 are associated with Pseudohypoaldosteronism type II, a form of hypertension. WNK is also involved in developmental and cellular processes, but the molecular mechanisms underlying its regulation in these processes remain unknown. …”

Proteomic analysis of reproduction proteins involved in litter size from porcine placenta Autor Dong-Gi Lee (731388)

“…These results indicate that PSA and RBP4 are representative proteins involved in porcine fertility traits, and this finding may help to increase litter size of pigs.…”

Conserved elements in steroidogenesis machinery involved in cholesterol transport from humans to worms. Autor Jinjiang Fan (211493)

The equivalence principle involving electric charges: Rohrlich’s contribution for the discussion on that classical problem Autor Edgard de Freitas Diniz Evangelista (10478480)

“…The idealizations concerning the so-called “Einstein elevator” containing observers and test masses enable us to readily understand such a concept, however the scenario becomes more complex when there are electric charges involved because they emit radiation when accelerated. …”

Supplementary Material for: AMH and AMHR2 Involvement in Congenital Disorders of Sex Development Autor Brunello F.G. (11360232)

“…Anti-müllerian hormone (AMH) is 1 of the 2 testicular hormones involved in male development of the genitalia during fetal life. …”

Image_5_Identification of Domains and Factors Involved in MINIYO Nuclear Import.jpeg Autor Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Table_1_Identification of Domains and Factors Involved in MINIYO Nuclear Import.docx Autor Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Image_1_Identification of Domains and Factors Involved in MINIYO Nuclear Import.pdf Autor Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Image_2_Identification of Domains and Factors Involved in MINIYO Nuclear Import.tif Autor Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Image_4_Identification of Domains and Factors Involved in MINIYO Nuclear Import.tif Autor Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

N- and C-Terminal Hydrophobic Patches Are Involved in Fibrillation of Glucagon^† Autor Jesper Søndergaard Pedersen (2517001)

“…In contrast, under alkaline conditions, only a handful of the alanine mutants are capable of forming fibrils, suggesting that more side chains are involved in stabilizing interactions here. …”

Involvement of Microtubular Network and Its Motors in Productive Endocytic Trafficking of Mouse Polyomavirus Autor Vojtech Zila (561630)

Image_3_Identification of Domains and Factors Involved in MINIYO Nuclear Import.jpeg Autor Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Involvement of the selected genes in the colanic acid pathway and cloning under arabinose promoter. Autor Catherine Chaput (62317)

CLEC4F is involved in the presentation of α-GalCer to NKT cells. Autor Chih-Ya Yang (418735)

Multi-disciplinary interventions for chronic pain involving education: A systematic review Autor Shirdhya Joypaul (7456490)