Schematic illustration of the molecular processes involving MinD, MinE, and the membrane. Dahkki Mike Bonny (493197)

Mechanism of Vanadium-Catalyzed Deoxydehydration of Vicinal Diols: Spin-Crossover-Involved Processes Dahkki Yuan-Ye Jiang (1642738)

“…We found that the favorable mechanism involves the condensation of diols to form vanadium­(V) diolate, reduction of the vanadium­(V) diolate by PPh₃, and spin-crossover steps to form a triplet vanadium­(III) diolate. …”

Schematic representation of the domains of CHPV N involved in interaction with P and their functional importance. Dahkki Arindam Mondal (173896)

The basic stages involved in serial analysis of gene expression (SAGE) and microarray technology Dahkki D Paul Harkin (55001)

“…</p><p>Copyright © 2000 GenomeBiology.com</p> (a) SAGE is a sequence-based method of identifying differentially expressed cDNAs between two experimental samples. The technique involves the generation of gene-specific tags typically 10-14 basepairs in length []. …”

Alternations involving BioIE top-10 verbs in the CYP450 section. Dahkki K. Bretonnel Cohen (275264)

Supplementary Material for: Carcinoid Heart Disease without Severe Tricuspid Valve Involvement Dahkki Killu A.M. (3230166)

“…Herein, we report 2 cases of carcinoid-induced valvular heart disease; one case had no evidence of tricuspid valve involvement despite severe involvement of all other valves, while the other case was without severe tricuspid valve involvement.…”

A schematic of the scales involved in the model and the important events considered in each scale. Dahkki Hossein Bazmara (749931)

Involvement of PI3K in galectin-3 induced Rac1 activation. Dahkki Violet R. Mukaro (282939)

Expression of proteins involved in axonal survival and death pathways in the superior mesenteric ganglion. Dahkki Nahia Ezkurdia (506041)

Model of the apoA-I peptide probably involved in the heparin binding site. Dahkki Silvana A. Rosú (736124)

“…The sequence loaded involves residues 143–186 in the wt form (PLGEEMRDRARAHVDALRTHLAPYSDELRQ<b>R</b>LAARLEALKENGG). …”

WNK Signaling Is Involved in Neural Development via Lhx8/Awh Expression Dahkki Atsushi Sato (275996)

“…Some mutations in human WNK1 or WNK4 are associated with Pseudohypoaldosteronism type II, a form of hypertension. WNK is also involved in developmental and cellular processes, but the molecular mechanisms underlying its regulation in these processes remain unknown. …”

Proteomic analysis of reproduction proteins involved in litter size from porcine placenta Dahkki Dong-Gi Lee (731388)

“…These results indicate that PSA and RBP4 are representative proteins involved in porcine fertility traits, and this finding may help to increase litter size of pigs.…”

Conserved elements in steroidogenesis machinery involved in cholesterol transport from humans to worms. Dahkki Jinjiang Fan (211493)

The equivalence principle involving electric charges: Rohrlich’s contribution for the discussion on that classical problem Dahkki Edgard de Freitas Diniz Evangelista (10478480)

“…The idealizations concerning the so-called “Einstein elevator” containing observers and test masses enable us to readily understand such a concept, however the scenario becomes more complex when there are electric charges involved because they emit radiation when accelerated. …”

Supplementary Material for: AMH and AMHR2 Involvement in Congenital Disorders of Sex Development Dahkki Brunello F.G. (11360232)

“…Anti-müllerian hormone (AMH) is 1 of the 2 testicular hormones involved in male development of the genitalia during fetal life. …”

Image_5_Identification of Domains and Factors Involved in MINIYO Nuclear Import.jpeg Dahkki Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Table_1_Identification of Domains and Factors Involved in MINIYO Nuclear Import.docx Dahkki Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Image_1_Identification of Domains and Factors Involved in MINIYO Nuclear Import.pdf Dahkki Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Image_2_Identification of Domains and Factors Involved in MINIYO Nuclear Import.tif Dahkki Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”

Image_4_Identification of Domains and Factors Involved in MINIYO Nuclear Import.tif Dahkki Ramon Contreras (7364087)

“…Interestingly, IYO also interacts with GPN GTPases, which are involved in selective nuclear import of RNA polymerase II. …”