Binding free energy, number of H-bonds formed, amino acid residues involved in H-bonding, and bond lengths for the top 10 docked complexes. by Harmilan Kaur Mangat (11985512)

“…<p>Binding free energy, number of H-bonds formed, amino acid residues involved in H-bonding, and bond lengths for the top 10 docked complexes.…”

Approximate distances and residues involved in the coordination of Mn²⁺ in the best-defined (chain C) active site of Form A (7txg). by Anna I. Selezneva (16437417)

nAbs target epitopic regions involved in SU binding to susceptible cells or required for viral infectivity. by Lasse Toftdal Dynesen (15348154)

NMR identifies the Cx43-CT^234-382 residues involved in the interaction with Drb^1-300. by Cinzia Ambrosi (446348)

A BMP signaling pathway involved in DV identity restricts <i>wnt1</i> expression to the posterior. by Eleanor G. Clark (17015069)

Flow diagram applied to select studies that involve the function of miRNAs with the development, monitoring, or prognosis of Chagas cardiomyopathy. by Heriks Gomes Ribeiro (17889106)

Bifurcated Polymorphic Transition and Thermochromic Fluorescence of a Molecular Crystal Involving Three-Dimensional Supramolecular Gear Rotation by Yun-Hsuan Yang (18088273)

Cascade Reactions of Dialkynyl Fischer Carbene Complexes Involving Intramolecular Alkyne Insertions Oriented to the Synthesis of Functionalized Polycycles by José Barluenga (1997692)

“…In these cases, naphtalene derivatives substituted with a TMS-ketene are obtained in sequences that involve alkyne exo insertion followed by CO migration. …”

Normalised histograms of distances between atoms involved in backbone-backbone hydrogen bonds. by Stefan Auer (260906)

Schematic illustration of the molecular processes involving MinD, MinE, and the membrane. by Mike Bonny (493197)

Mechanism of Vanadium-Catalyzed Deoxydehydration of Vicinal Diols: Spin-Crossover-Involved Processes by Yuan-Ye Jiang (1642738)

“…We found that the favorable mechanism involves the condensation of diols to form vanadium­(V) diolate, reduction of the vanadium­(V) diolate by PPh₃, and spin-crossover steps to form a triplet vanadium­(III) diolate. …”

Schematic representation of the domains of CHPV N involved in interaction with P and their functional importance. by Arindam Mondal (173896)

The basic stages involved in serial analysis of gene expression (SAGE) and microarray technology by D Paul Harkin (55001)

“…</p><p>Copyright © 2000 GenomeBiology.com</p> (a) SAGE is a sequence-based method of identifying differentially expressed cDNAs between two experimental samples. The technique involves the generation of gene-specific tags typically 10-14 basepairs in length []. …”

Alternations involving BioIE top-10 verbs in the CYP450 section. by K. Bretonnel Cohen (275264)

Supplementary Material for: Carcinoid Heart Disease without Severe Tricuspid Valve Involvement by Killu A.M. (3230166)

“…Herein, we report 2 cases of carcinoid-induced valvular heart disease; one case had no evidence of tricuspid valve involvement despite severe involvement of all other valves, while the other case was without severe tricuspid valve involvement.…”

A schematic of the scales involved in the model and the important events considered in each scale. by Hossein Bazmara (749931)

Involvement of PI3K in galectin-3 induced Rac1 activation. by Violet R. Mukaro (282939)

Expression of proteins involved in axonal survival and death pathways in the superior mesenteric ganglion. by Nahia Ezkurdia (506041)

Model of the apoA-I peptide probably involved in the heparin binding site. by Silvana A. Rosú (736124)

“…The sequence loaded involves residues 143–186 in the wt form (PLGEEMRDRARAHVDALRTHLAPYSDELRQ<b>R</b>LAARLEALKENGG). …”

WNK Signaling Is Involved in Neural Development via Lhx8/Awh Expression by Atsushi Sato (275996)

“…Some mutations in human WNK1 or WNK4 are associated with Pseudohypoaldosteronism type II, a form of hypertension. WNK is also involved in developmental and cellular processes, but the molecular mechanisms underlying its regulation in these processes remain unknown. …”